GenomeNet

>tml:GSTUM_00010406001 hypothetical protein; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MKPHRIRMTHSLIMNYRLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSKVTPDNMEQYSK
EQGKYNVGDDCPVFDGLFEFCGISGGGSMEGAARLNRGKCDIAINWAGGLHHAKKSEASG
FCYVNDIVLGIIELLRYKQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
ELRDIGVGAGKYYAVNFPLRDGITDTTYKEVFEPVIGHVMEFYQPDAVVLQCGADSLSGD
RLGCFNLSMAGHANCVEYVKKFNLPTLVVGGGGYTMRNVSRAWTYETGILVNQKVGPNLP
FSDFYEYFGPDYELDVRPSNMENLNSKEYLEKIKIQVLSNLERTRHAPSVQTTDVGKGLT
EHQEEQDAILDDIDEDGPGMDARQTQRQWDRATEKEGELYSDSEDEEITSSMGVRKTSKK
GLRNVRDWKEGGSGTGSGNATPFTGPGGSDNASESAGGNTAKGSGATSKRDGEGRDLTEF
DEELEALRKETEEEVQPDNDGDVEMGDDEQPPPSADALTDEVADEEMTDVPAQSSTSSTK
VDPIPTAESLSQAKPEAATTDDKIRVEASEFSKAETPAKGSGSGVPKPSESSVANAAPEG
SNSMASTTDRHSSKPPLVADESVSSTAKAPANPVEAPAKEEK

BLAST