GenomeNet

>tmn:UCRPA7_8183 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) putative alpha-amylase protein (A)
MGDEQKPTPENMTMMQGFEWYVPADHKHWIRLEKHVPQLKSWGIDNIWIPPGCKGSSKEG
NGYDIYDLYDLGEFDQKGTTVTKWGSFEELMKLAETAKKTGVGLYWDAVLNHKFAADHKE
KCLAQEVDQDDRTKFVSDKYEIDAWVGFDFPGRGDKYSPMKYHWYHFSGVDYNAANNKTA
IYKIMGEQGEGWAAVPDVDSEKGNYDFLMGSDLDYSHPEVEEDVLNWGKWLASTVPLKGF
RFDAIKHYSEDFLRKFITKMDETYGQGWFVVGEFWKDSLDDMTKYLDRMGKKFSLFDAPL
VYNFSQISQGNGADIRQIFDDTLVQKAPMCAVTLVMNHDTQPYQALEAPVADWFKPLAYA
LILLRIDGYPCVWYGDLYGIKGEHPFPPSCGGNLPKIMLARKLYAYGKLADYFDYATCIG
WVRYGTWDRPYGCATVLSNAGAGTKRMHVGEQHAGEKWTDVLGWSDREVEIGEDGFGEFV
CGQTSVSIFVNKDAEGRDKFAESFDSNIYEE

BLAST