GenomeNet

>tol:TOL_2191 K01113 alkaline phosphatase D [EC:3.1.3.1] | (GenBank) hypothetical protein (A)
MLLNRISIKTYLLGMWFIGISMLSASVEAAVQTDGPMVGAVTHVRAKVFLRTDAPAQVQI
EFSESSSMSNSLKTPKEVTRYANDFTKIVTLKGLIPGTKYYYRVLVDGVAQQTENYPSFT
TFAPLGQDAEFSFGLLSDVGNYVKNPAGAYKTLADAKPDFVLQIGDWDHRDPANLREMRK
MHRDVRGSGSDAGADFSQFLAPVAPLFHMWDDHDYGMNDGDYTFPEKASAIKAFLEYYPL
PDLPNPQAGPWYKFRYAQAEFFVLDTRSNRDPNGDVDDANKSMLDGENIENDQKTWLYDS
LLTSPAKWKFITSGSPFNPTCKPADGWGAFVTEHDEIVDFVKDNNIKGVIILSGDIHSGG
AMDDGTNSGLIEFSVPHTNMQMSPVNGGFTTTTPGDWSEYLNPGVSAGGSSNAGFGWINV
LTNPDRVEIQVVHENGDVTNSDTIVFDEM

BLAST