GenomeNet

>tpd:Teth39_2112 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MIYGSLDHGFIEVIVGPMFSGKSEELIRRIKRAQIAKQKVQVFKPAIDDRYSIDKVVSHN
GTNINAISVVKAFEIIELLEEDTEVIAIDEIQFFDHSIVDVVREIADLGKRVICAGLDMD
FRGEPFGPTPDVMAIAESVDKLTAICVKCGNPATRTQRLINGKPAKYDDPIILVGAHETY
EARCRKCHEVPRT

BLAST