GenomeNet

>tped:TPE_0275 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) hypothetical protein (A)
MKNFKFAALIAAIIFTALFVSCPTAKNIPEGGNEEANKNENKEKKPPYDVWKDSSRDKSY
ATVFEGDKGPIGVDNQKGFYRIPALTVTKDGVLLAFADKRFGDNMDTGYDIPISGGIAQS
GNYKNKNKPSDIVMRKSSDAGKTWSEETVCARGDGHGQQQAHNDAENNSITSVTKPQDGK
YAGHCDAVPAADRDSGQLLFLTCSGSSNYDNQNGPNYLLCFTSLDGGKTWSKNDISGQVE
TATGTTGTQKAGGKRFFGSGRATQSKIHKKGSHYRVYAHVGINGKGYVMYTDDFGSNWKM
LKGLGGSGEITGWDEVKVTEFDDGSLLIVGKQKRNLNPHANPLTVFRYSDVENGTGTFEN
NVNVQKIAGTECNGDMIIVKAKKTASGEKVNLVLASYPLGLKSGAASASEISGARSSTNF
SRFNIGIYWKEFEGDAVTLPEATSFNSGWCTTPYRVQGNEDIEGVYSVMQELPNKNIGIL
YEEGPATRAELKNGQKIPFKGYQYGDWNVIKYKELDISDITGGQYSKL

BLAST