GenomeNet

>tpf:TPHA_0B03550 TPHA0B03550; hypothetical protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MPRGIKNHLLFEIATEVANRVGGIYSVLKSKTPVTVQQYHDKYHLIGPLNFDTYQNEVET
IDIYDINNFISKDSSDSNNSDEDPDGLLAVRDTLISMKEKNVNFVYGRWLIEGAPRVILF
DLNSLQGYLNDWKSDIWNLVGIPTPESDLETNNAVLLGYAVVWFLGELVTRDSTHAIIAH
FHEWLAGIALPLCRKKRIDVVTIFTTHATILGRYLCASGETDFYNTLQDIDVDHEAGKFG
IYHRYCIERAAAHTADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVTKFQAVHEFQNLH
AVKKEKINDFVQGHFHGCYDFNLDDTLYFFIAGRYEYKNKGADMYIEALARLNYRLKVSG
SKKTVVAFIIMPAKTNSFTVEALRSQAVVKSLENTVNEVTKLISRRIFDHAMKYPHFGIN
NEIPTDLNELLHDSDKVLLKRRVLALRRPYGQLPPVVTHNMCDDDADPILNKIRHVQLFN
NQSDRVKVIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSI
TTNLSGFGAYMEDLIERDQAKDYGIYIVDRRFKNPDESVEQLVDYMEEFVKKNRRQRINQ
RNRTERLSDILDWKRMGLEYIKARQLALYRAYPDVFKQYATANGEEDNINDTDMYSMAGD
KKIKIKRSLSVPGSPTDFRLRSGSITPSTVYMTPGDLGTLQDAVNADDYFVLSNDKEFDD
DEA

BLAST