GenomeNet

>tpf:TPHA_0B04850 TPHA0B04850; hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MSFNELHKACEEKLSKEVDEICEQFVVDSDKLAQMTEHFIDQMEKGLQPLPADVSEATDR
GLPMIPSFVTGLPNGSERGVLLAADLGGTNFRICSVSLFGDHTFKLEQLKSKIPDELLED
ENVSSKDLFSYMARRTLAFIKKHHPDAMEKGASAPVMKMGFTFSYPVNQTSLNSGTLIRW
TKGFKIADTVGKDVVQLYQDELDAEGLPFVKVVALTNDTVGTLLSHSYVSESGSSLCSGE
ISEPVIGCIFGTGTNGCYMEEINNISKLSPDIREKLIAEGKTHMIINTEWGSFDNDMKVL
PTTKYDIDVDQKYSTNPGFHLFEKRVSGMYMGEILRNILVDLHCRGLLFNHYKSYNELPH
RLRTPFELGSEVLSHIEIDDSNDLRETELSLLQSLRLPTTSLERVEIRKIVRAISRRSAY
LSAVPIASIIKKTKSLHKRYHGEVEVGCDGSVIEFYPGFRSMIRHALALSPIGSEGERKV
HLKIAKDGSGVGAALCALVA

BLAST