GenomeNet

>tpf:TPHA_0E02930 TPHA0E02930; hypothetical protein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLHLKRNFINKQRSISSSLYKYTTARGLATAKNNIDDLTSKYNLIDHEYDCVVVGAGGAG
LRAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNVHPDNWKWHMYDTVKGSDWL
GDQDSIHYMTKEAPASIIELEHYGMPFSRLPDGKIYQRAFGGQSKDYGKKGQAYRTCAVA
DRTGHAMLHTLYGQALNHDTHFFIEYFAMDLLTHNGEVKGIIAYNQEDGTIHRFKAHKTI
IATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARG
EGGYLINSEGERFMERYAPTAKDLASRDVVSRAITMEINAGRGVGKNKDHMLLQLSHLPP
EVLKERLPGISETASIFAGVDVTKQPIPILPTVHYNMGGIPTKYTGEALTIDEETGEDKV
IPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIADQLQPGLPHKPLPQDIGKE
SLQRLDRIRNSSGKIPTADIRLKMQKAMQKNVSVFRIQDTLDKGVEEVTAIDKTYKDDVH
VSDRSMIWNSDLVETMELENLLTCAMQTATSAAARKESRGAHAREDYPTRDDDHWMKHTL
SWQKNTGDKVDLKYRKVIYKTLDEKECPSVPPAIRSY

BLAST