GenomeNet

>tpf:TPHA_0G03730 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) TPHA0G03730; hypothetical protein (A)
MVHLGPKKPPARKGSMIDMPKELKDDLQAIVSSFDVSTETLHAVVKHFITELDKGLSKKG
GNIPMIPGWVLEYPTGKESGDFLAIDLGGTNLRVVLVELGGDRTFDTTQSKYKIPTAMRT
TQDPEELWAFIADSLDSFVKERFPEGVDKPLPLGFTFSYPASQERINSGVLQRWTKGFDI
PDTEGRDVVTLLRKQLEIRKTPIEVVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSGIEKLEGRLASDITPDMPMAINCEYGSFDNEHVVLPRNKYDIQIDNESPRPGQQA
FEKMSSGYYLGELVRLSLLDLYNQGHIFKGQDVTKLKTPYVMDTSFPSKIEDDPFENLEN
TDELFQNELNIQTTASEREIIRRICEAVGVRAARVSACGIAAICQKMGYETGHIAADGSV
FNLYPGFKERVHAALKDIYGWKEESDYKKYPIVVVPAEDGSGAGAAIIAALTQKRLAAGK
SVGVSN

BLAST