GenomeNet

>tpf:TPHA_0K01030 TPHA0K01030; hypothetical protein; K02358 elongation factor Tu (A)
MFLSKSAYLISRTRFASVVPRVSFLATRGYAAAFDRSKPHVNVGTIGHVDHGKTTLTAAI
TKTLASKGGADFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADYIKNM
ITGAAQMDGAIIVVAASDGQMPQTREHLLLARQVGVQNLVVFVNKVDTVDDAEMLELVEM
EMRELLTQYGFDGDNVPVIMGSALCALEGREPEIGEKAIMKLLDAVDEYIPTPARDLEKP
FLMPVEDIFSISGRGTVVTGRVERGELKKNEEVEIVGHTKTPIKTTVTGIEMFRKELDQA
MAGDNAGVLVRGIRRDQIKRGMVLAKPGTVKAHTKVLASLYILSKEEGGRHSGFGENYRP
QMFIRTADVTVVLRFPESVEDHSKQVMPGDNVEMECELIHPTPIELGQRFNIREGGKTVG
TGLITRIIE

BLAST