GenomeNet

>tpf:TPHA_0K01030 K02358 elongation factor Tu | (RefSeq) TPHA0K01030; hypothetical protein (A)
MFLSKSAYLISRTRFASVVPRVSFLATRGYAAAFDRSKPHVNVGTIGHVDHGKTTLTAAI
TKTLASKGGADFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADYIKNM
ITGAAQMDGAIIVVAASDGQMPQTREHLLLARQVGVQNLVVFVNKVDTVDDAEMLELVEM
EMRELLTQYGFDGDNVPVIMGSALCALEGREPEIGEKAIMKLLDAVDEYIPTPARDLEKP
FLMPVEDIFSISGRGTVVTGRVERGELKKNEEVEIVGHTKTPIKTTVTGIEMFRKELDQA
MAGDNAGVLVRGIRRDQIKRGMVLAKPGTVKAHTKVLASLYILSKEEGGRHSGFGENYRP
QMFIRTADVTVVLRFPESVEDHSKQVMPGDNVEMECELIHPTPIELGQRFNIREGGKTVG
TGLITRIIE

BLAST