GenomeNet

>tpf:TPHA_0K01360 K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] | (RefSeq) TPHA0K01360; hypothetical protein (A)
MTISSEYYPNEPERPILKSIEPSEETINQLNELSKVFDTRAVYFIADYEKSIGNYICDLD
GNYYLDLYQQIASIALGYNNPLLIEAAKSQEMIESLVERPAMGNFPSKRLPKQLQNLLRF
APNGQNKIWSGLSGSDANELAFKAAFMYYCGKKRGFKTKYTEDENASVMDNQAPGSPDLA
VLSFKNAFHGRLFATASVTCSKPIHKLDLPAFNWPHAPYPVYKYPLEDNQEFNKKVDDEC
VLNVEEIIKTWYCPVAALIIEPIQSEGGDNHASALFFAVFERITLKYGIVYIIDEVQTGV
GATGKMWCHEHAAIEPPPDLVTFSKKFQSAGYFFHDPDFIPNMKYRQFNTWCGDPARFLI
ANVICEEIVKKDLITHVNEVGDYLMSKLTKLAVVYPNYLQRLRGANRATFIAWDVENNEQ
RDELLALLKSNGCNVGGCSTKSIRLRPSLTFDIKHADIFIEALEKSLYELSA

BLAST