GenomeNet

>tpf:TPHA_0O01130 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) TPHA0O01130; hypothetical protein (A)
MGRDLENQLLFEVATEVANKVGGIYSVLKSKALVTIAQYHDNYTLIGPLNRATYQTEVEE
LDWENMHSHDSDSTASIKKVLIRMSERGVRFVYGNWLIEGSPKVILFELNSLSGYLNEWK
ADLWNLVGIPSPENDNETNDAILLGYVVTWFLGELAYINESDTIIAHFHEWLAGVALPLC
RKRRIDVVTIFTTHATLLGRYLCASGDVDFYNNLQNFDVDHEAGKYGIYHRYCIERAAAH
SADVFTTVSHITALEAEHLLKRKPDGILPNGLNVKKFQAYHEFQNLHALKKEKINDFVKG
HFHGSLDFEIDDTLYFFIAGRYEYKNKGVDMYIEALARLNYRLKVSGCKKTVVAFIIMPA
KNNSFTVEALRGQAVVKSLENTVNEVTELIGKRIFDHALKYPHMGITTELPTTLEDLLTD
SDKILLKKRTLNLRRADGELPPVVTHNMADNSSDPVLNKIRSVQLFNNSSDRVKMIFHPE
FLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMED
LIEANQAKDYGIYIVDRRFKNPEESIEQLVDYIEDFVNKNRRQRINQRNRTERLSDLLDW
KRMGLEYIKARQLALFRAYPDEFKNQISQSTKMTEDSNLDSMTGETKFKISRPLSVPGSP
KNSVIKTPNGNNDIRTVFMTPGDLGTLQDANNADDYFHLGLNDDDDDDGSTY

BLAST