GenomeNet

>tpf:TPHA_0O01950 TPHA0O01950; hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MQNTNIGNVSQLSSALRHVNINNNESAGNMNKNGSNEILFGGNDMINNNGDNDKNNIMQQ
QLNQQQSNQQNGTEQQQDQQLQQGHHTNAHQQVHLEDMLHPFTIQQQQQQQQAQQQAQNI
LGSEYNPAQHSRITQYFQNLPVEGYTLFSHRSAPNGYKVACALSELGLQYNTFFLDFATG
EHRAPEFVSLNPNARVPALIDHSLENLGIWESGSIMLHLVNKYYKETGDPLLWSDNLAEQ
SQINSWIFFQTSGHAPMIGQALHFKYFHSQKIPSAIERYTDEVRRVYGVLEVALAERREA
LVMELDTENVASYSAGTTPISQSKFFDYPVWLVGENITIADLSFLPWNNVIDRIGINIRV
EFPEVYKWTKHMMRRPAIIQALRGE

BLAST