GenomeNet

>tpf:TPHA_0O01950 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) TPHA0O01950; hypothetical protein (A)
MQNTNIGNVSQLSSALRHVNINNNESAGNMNKNGSNEILFGGNDMINNNGDNDKNNIMQQ
QLNQQQSNQQNGTEQQQDQQLQQGHHTNAHQQVHLEDMLHPFTIQQQQQQQQAQQQAQNI
LGSEYNPAQHSRITQYFQNLPVEGYTLFSHRSAPNGYKVACALSELGLQYNTFFLDFATG
EHRAPEFVSLNPNARVPALIDHSLENLGIWESGSIMLHLVNKYYKETGDPLLWSDNLAEQ
SQINSWIFFQTSGHAPMIGQALHFKYFHSQKIPSAIERYTDEVRRVYGVLEVALAERREA
LVMELDTENVASYSAGTTPISQSKFFDYPVWLVGENITIADLSFLPWNNVIDRIGINIRV
EFPEVYKWTKHMMRRPAIIQALRGE

BLAST