GenomeNet

>tpr:Tpau_4038 DNA primase small subunit (A)
MAKAPAAEVIVPGGDGADRAVRVSSPDRIIYPATDLTSAVSKLQVAQYFAAVGGPLLAAI
GDRPTALERWPGGVHPGGRLAQGPQDKDADGFYQKRMMKGAPPYAQTVRIAFPSGRPADE
LCPSEIAIPVWCAQMGTITFHPWPVRSADVDRPDELRIDLDPQPGTDFGDVVRVAAIARQ
LFADLGMRAFCKTSGNRGVHVFVRIEPRWEFTDVRHAAIAFGRELEKRDDGVTTAWWKEE
RGERIFVDYNQNCRDRTIASAWSLRAVQGATVSTPLTWEELAEVTDPRMFNLFTVPERLA
DGNPWAEMDEVAHDLTPLLQKWEEHPVELNFPPDYPKMPGEPPRVQPSKKVAEHWDADGN
RIDQ

BLAST