GenomeNet

>tps:THAPSDRAFT_17735 hypothetical protein; K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] (A)
YNLCFVRHGQSTWNRDNRFIGWTDTPLTEDGVLEARVAGRMLRSSGMLFDEAHTSLLRRS
IRTTNLVLMEMGQEYIPVQKHWRLNERSYGDLVGLNKKEIVKKFGKEQVLRWRRSYDEPP
PPMNEDHDHHPKRDPRYRLMLDEIPSSESLKCTKARSKIYWDDVIAPSLRSGKTVLIVGH
ENNLRSLIMRLEGILPDDIINLNLPRAVPLAYRLDKDLKPL

BLAST