GenomeNet

>tps:THAPSDRAFT_268872 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) set-domain-containing protein (A)
MFQGNIEKIAVTIGASIESVKAFVKTNKVELSPPKHDVVASNKRKDKTTEYTSMKNYNQN
WLKSIQSKEIHPSFIPCDHSEPCNEETCSCIQNAFFCTKHCGWGSKSRNFFRGCACKAGQ
CRTSSCACYAAKRECDPDLCRTCGTCEDPPDKPAEKQRCRNDNLSMRRHIHCLLGESTIA
NAGWGLFTKHSLKKGDFIHEYVGEVISQEEAERRGIIYDKLNMSYLFNLSSDFVVDATRK
GNKARYANHSSTPNCEPRMIRVNGDMRIGLFAREDIDAQSELFFDYRYDDEMDNDLIVKS
AHKPVWIKRGKASSKSTNIAL

BLAST