GenomeNet

>tps:THAPSDRAFT_42475 succinate dehydrogenase flavoprotein subunit (EC:1.3.5.1); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLSAFARRASSKATKLASTAPTPTTAVRSLSTSTTGDYTIVDHTYDALVIGAGGSGLRAA
MGLSEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMGPDDWRWHMYDTVKGSDWLGDQD
AIHYMCREAPKAVLELEEFGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAHRCCAAADRTG
HAMLHTLYGRSLAFDTTYFIEYFAMDLLMTPDGQCVGAMALNMEDGTLHRIKAKNTVLAT
GGYGRTYFSCTSAHTCTGDGNAMAMRAGLANQDAEFVQFHPTGIYGAGCLITEGCRGEGG
ILRNSEGERFMERYAPSAKDLASRDVVSRAMTMEIREGRGVGPKKDHCYLHLDHLPAELL
AERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHLGEVIRTDFNADGSFNSDV
VVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRIAEIAKPGDAIADAPADVGM
DSVAELDKLRFATGSTPTSVIRGEMQHLMQDKAAVYRTEELLAEGKKEIDEVVQSFNDVH
VTDKSLIWNTDLVETLELRNLLGCAATTMHSAENRKESRGAHAHENYPDRLDDEWMKHTL
AYFDEKEGKTKIGYRPIHYYTLDEEECKTVPPVARVY

BLAST