GenomeNet

>tps:THAPSDRAFT_bd2088 RBL; ribulose-bisphosphate carboxylase, large subunit or chain, chloroplast, RuBisCo; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSQSVSERTRIKSDRYESGVIPYAKMGYWDAAYTVKDTDVLALFRITPQPGVDPVEAAAA
VAGESSTATWTVVWTDLLTACERYRAKAYRVDPVPSATDQYFAFIAYECDLFEEASLSNL
TASIIGNVFGFKAISALRLEDMRIPHSYLKTFQGPATGIVVERERLNKYGTPLLGATVKP
KLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRERFLNCLEGINRASAATGEVK
GSYLNITAATMEEVYKRAEYAKMIGSVIVMIDLVMGYTAIQSIAYWARENDMLLHLHRAG
NSTYARQKNHGINFRVICKWMRMSGVDHIHAGTVVGKLEGDPLMIKGFYDILRLTELEVN
LPFGIFFEMDWASLRRCMPVASGGIHCGQMHQLIHYLGDDVVLQFGGGTIGHPDGIQAGA
TANRVALEAMVLARNEGLDYFNQQVGPQILRDAAKTCGPLQTALDLWKDISFNYTSTDTA
DFAETATANR

BLAST