GenomeNet

>tpx:Turpa_1788 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain-containing protein (A)
MRLISISISHYVEKVKWALQLAGLPFTEESYIPGLHAAVTLWHTGGRHRATPVLIDDGEV
IPDSTAILQHLAARYRQTWLYAHPEALVLEERFDASIGPHTRRFIYRHLFDNELSLAEIF
SQDVVPAWQKRMLPLAAPMLKAGMIAEMAIYHDEAERSRLVFEAEFAYVDKLLQDGRPFL
CGEKISAADITFAALAAPVILPSEYGARLPDLNSVKPGSTLPAVIEGYRNTTAGKYVQRL
YRENRR

BLAST