GenomeNet

>tpx:Turpa_1972 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-alanine--D-alanine ligase domain protein (A)
MRVLVAFDFPTALPKNGDYRSLLHAEDWRPTRNVMEAIARLGHEPILQGVYDDILPLVFT
IKRKKPDIVFNLLESFRQKRHYEGALAGLFDLLQVPYTGCSAEALTICRNKSYTKLLLRH
TKIKFPRSVVFPRGKTNRSIKDLKFPVIVKPLGLEGSDGISQASFVADEAACIERVKTLH
ETYEVDALAEEYIEGREIYAGVLGLEKLTALPLREMLFTNFPEDRPKFATFHAKWNPEFR
KKWGIKNTFAKGIDEKTQADIEQISKSAFRALGLSGFARLDLRLTDKNEIFVLEVNPNPN
IANDDEIAYASQRLGISYDQLIQKLLDYGKRRRG

BLAST