GenomeNet

>tpz:Tph_c08080 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD1; ATP-dependent DNA ligase (A)
MPVADKKVLVAIEGKELQLSNLDKVLYPAGGFTKAQVIDYYTKISPALLPHLRGRPVTFK
RYPDGVRGESFYQKECPARRPQWLRTAPLRIRGGREINYCLLEDLPSLIWAANLAALELH
TSLSLADDPLSPNFLAFDLDPGPPAGIIECCRVALILSRLLRRFHLEGFPKTSGSKGLQV
YVPLNTPVSYERTKGFARACAEALEIQLPELVVSRMRKDLRTGKVFIDWSQNDPHKTTIS
VYSLRARERPTVSTPVSWSEVEAAVKRDDPELLFFEAEEAIERFAKWGDLFGPVVEKQQV
LPCFQ

BLAST