GenomeNet

>tra:Trad_0748 catalytic domain of components of various dehydrogenase complexes; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MPRELVLPELAESVVEGEIVKWLVAEGETVAQDQPVVEVMTDKVTVELPSPFAGTLEKHL
VAEGAVVAVHDPIALFSDDATGTQEAGATAEEAPKLEVAEAPTADAPPVTPTGREPSVQA
REERSIVEPSSGVGEDDGDALSLFKADKDDPGAPVYQVRRGAAPQAAKATGPYGRPLAVP
AARKLARELGLELTAVAGSGPHGRIRVEDVRRAAEASAPAAAEPPSAPAPTPKAPAYKTP
AGYEGLEERVPVRGLRRAIANQMVASHLQTVRTLHVDEVDVTELVALRERLKPLAERRGV
KLSYLPFIMKAAVAALKRFPVLNASFDEERGEIVLKRFYNLGLAVATDVGLVVPVVKDVD
RKSVLEIAGEVSALAAKAREGKLAPEDVRGGTFSITNIGSLGGLFSFPIINVPEAAILGV
HSIKKRPVVLPDDTIAARQMLYLSLSFDHRLVDGAEAAQFTSYVIELLGSPESLMLEG

BLAST