GenomeNet

>trq:TRQ2_0983 alpha amylase catalytic subunit; K01176 alpha-amylase [EC:3.2.1.1] (A)
MKKTFLLLALVFLLFLTSCFQTSMSQSLVSSNPHSNSTNTGDSASNLSINEVKYPVVYEI
FIRSFYDSDGDGVGDINGVSQKVDYLRKLGIDAVWFMPFNEAVSYHGYDITDYYNVEKDY
GTMEDLENMIQVLHENGIKVIMDLVINHTSDEHPWFKDAVENTTSSPYWDYYIMSLEDHS
GQGHWHWKINSKGQKVWYFGLFGYNMPDLNHDSQKVREEVKKIVDFWISKGVDGFRIDAA
KHIYGWSWDDGIQESAEYFEWFRDYVLSKKPDAILVGEVFSGNTYDLSLYPIPVFNFALM
YSIRNYPEGQDGMIENNWVEESFLFLENHDLHRFFSHLQEHYKKFSESDYEFIKKRAALW
YFLIFTLKGSPVIYYGGEIGTRGFKWHGPVYDEPVREPMQWYASGTGEGQTFWTKEVYKN
AGITFGNADVDGCIYDDPYDGFSVEEQENDPKSLLNFIRFILNFRKDHDAILNGDQTIFR
DWKNLIAFYRESSNEKLLVVLNPDPVWQNSFTFEENMTMILEVDFENFIWNESNVSFSAG
ESFTVDPMKAYIFKK

BLAST