GenomeNet

>tru:101063302 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tk1; thymidine kinase 1 (A)
MELGGFSKILPNSPKNARGQIQVIFGPMFSGKSTELMRRVRRFQLAQYKCLVIKYAKDTR
YSDSGMATHDKNTMEAVPANRLGDVHSQALQVCVIGVDEGQFFPDIVEFCEEMANLGKTI
IVAALDGTFQRKPFGSILNLVPLAESVVKLNAVCMQCFKEAAYTKRIGAEKEVEVIGGAD
KYQAVCRKCYGDLMVDKENRSPCSDETPPHDHLEKLKDSAVPRKLFSSVIL

BLAST