GenomeNet

>tru:101067089 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 2-like (A)
MESCDLNIKSNNSNHHTDRYGDQRLVVRRGQPFSVLLHLKPDFKLSETSFIVETGPLPRE
ESDTKACFGLGDSTVDTEWSASATADPSGNTVSVSISPPPTAPIGLYSLTLEQEGQKVKL
GEFTLLFNAWCRGDAVYMRSETKRKEYVLAQHGLVYRGTHKRIKGTPWNYGQFDPDILDI
CLMILDSNPKFVSDADQDCSARRNPIYVTRVLSAMINSNDDRGVLVGEWHDYSDGVPPGR
WIGSADILRQWAESGPVRYGQCWVFAAVACTVSRALGIPCRVVSNFGSAHDSDANLIIEN
LYDENGENISQSDSIWNFHVWVDSWMTRPDLGSEFDGWQTSDPTPQETSEGVFCCGPAPV
RAIKEGELTKKYDAPFIFAEVNADVVDLVRLSDGQIVKFGGSTKSVGRFISTKAVGSEER
HDITHQYKYPEGSPEERQVYEKAQHRNKLQQRGEEPGLHLKIKLAHDMIVGSDFEVFAVL
TNNCMEARTCSFMFFAKTVSYNGKLGESCGFASQKVEVAPGEDKRLSLLVEYDQYGPKIT
SDRLIQLSAITIDKNAMDFHKAEKTVVLDEPDIEIQLSGEAKVSQLLTAELTLLNPLPEL
LQDCSFTIEGVGLTEGKPLTHRIEDVGPRQEAKASLQFSPSRAGATVLLVNFDSDKLNNI
KSCINVDVRE

BLAST