GenomeNet

>tru:101071398 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) coagulation factor XIII A chain-like (A)
MSDPAPVVDPSPAPAAPSGPRPKVTNRGRTAVAVASSNSESTEVPEFESFVALSPRGFPP
LTDYLDIVAVDMMSQSDGVNKQQHRTMFYNSNYLIVRRGQEFHVKLTFNRPYNPKEDKFA
LEFVIGANPDYSKGTYIPVFPNKERQSRWAGRIADSSNNDVTVGITPLANCIVGKYHMYI
AVMTPFGIRRTRKDPVRDLYILFNPWSPADDVFLDDEPERQECVMNEMGIIYHGAYDDIA
ERQWNYGQFNYGVLDACLYIMDRSEMPITNRGDPIKVTRKASAMLNSRDDDGVLVGNWSG
DYTYGVAPTSWTGSTEILLTYASSRMPVSYAQCWVYAAVFNTFLRCLGIPSRVVTNYYSA
HDNDGNLKTDIILDENGKIDRSRTRDSIWNYHCWNECYMTRPDLPFGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGEMCYPFDAAFVFAEVNSDVVFYSRGKDGAMQPVRVNQTHVG
RMVLTKAPGATTRRDITSQYKFPEGTSEERTVLEKAEGFGCHREKSRPPEADVDLVLPTL
EVPVGQDFELSLEFVNRSDQRRVVEAYISGNVVFYTGVTSAEFMLRDPTVTMKPNETVKE
TVVVESKKYMKHLVEQANLHFIITGKVKETGQIVTAMKVVALHNPKLSVKVSGENRVSEE
MMATVEFTNPFSFALADVYIRMEGPGVMMPTYKYYSLIPNGSSLTWTEMFVPQRAGATRV
FATLDCPALRQVQGEVSLTIKP

BLAST