GenomeNet

>tsp:Tsp_01435 angiotensin-converting enzyme, testis-specific isoform; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MQHNHTTLGRLSIVKHCLWAVAIDSFESFKRCLVMNASLCRSVTMKALIAKRSFENGQQS
AAIPSHSQIIFTNGCWLLLNVFITLSSSQRPDGTTRAPPQAIASENVVNELISRLLSGNG
GDISSDLQQNSINIPTVNGGTVNRDDPYWNASDILEPNSVNDETAALKFLVDYDKQAEEV
FSKSAEAGWCFLTNMTANTRKELAEMDKTVVEFLHISAKRAKQFNLNSIHNKKAKKQIKN
LSQEGIYVLPEKKLEQFISVQAKINQVFADGTVCEPSRPPPCTMPLEPDLQRIMATSHDV
NELYYVWLAWRNAVGPPMKQSYLEMVELFNEIAKLNGLKHGGEIWQNTYGEKVNLINLLE
KIYDEVRPLYDQLHAYIRNQLRKQYASFMHQDGQIPAHLLVKFSTGDMSGSNWINLYPDS
VPYPEHHPLDVNYHLKSLNYTVEKMVRTAEKLFTSMGFGRLPKSFWDYSIFVRPNDRDMV
CYPAAFDFKNQKDFRIKMCAQVTWEDFIQLIRQMTSTYYQIAYKEQPISFREAANPAISY
ALTNALALSVSSEDFMHSVGILPDLENSQEKTINYLYNIALREVAFIPYGVLADKWRWSL
FSGDIDATNMNEKWWEYRMKYQGVKSPARRDSNDFDPGSNYQIAQNLPFSRQVNVIGYVI
QFQVLKGLCSAIGYQGPLHRCHFFEGKLAGEKLISAMKLGASENWTDVLKILSGSEEISG
AAMMEYMEPLIQWLVKTNAETGETIGWNEYPDQFNEAEITLAKNISKKLPVGDIKNNAHS
VSDLEGIAFPGEDCSQGQQCLADSTCNGTVCVCPPNSVPWYQTCLPNDPTMVGFGPGGEG
FQLDLIKEELVTEESTSSQEESNDINGSTSSMQWKWLSIFSASVAEKYLPADTGCSYAAE
QLSDDFSLYYNHQ

BLAST