GenomeNet

>tsp:Tsp_01566 K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] | (RefSeq) putative SET domain protein (A)
MDILYSRKRLVGRTRVEKSAEGTPTLEETKMMMDIYDEIMKDYKQPVSKVKVNDSYLSNY
EALVQDLWRDSQRMPYPNEDRVSVVDVDTVSCFNEKSENPSNSYNLFVMKIDEKTNSHTK
NWMMIPKNFLGRPCYDLRTLRDDQQENNDHRFLPDFAFYKLVLKASEVFYNQNITDQWSG
ELILPNDRLFTIIHHLFPHKLSANNLKELFIHIFCMLNEKKGNNKLQHLNDRESIFVKAF
CPICFQFCCTTHGESLVDPMYVHNYNPKLNKKSKVKDPCGKFCYLKSLDKNTVRVLRHNS
SKSKASKVKLEWTAEKEEMLRALESLFGSNSCIIAECLNTPYCSEVYARIVKSESVASTS
WKIEEEKWKMPEIPQKMVKSEAYSTRSCVNNKVLLYSSGSSDTDSDWDSDGEGMEAYKPC
YCRGRCRDNANCSCNEREYCEKYCRCSDNCSKKYLGCNCKGVCHRKVCLCMKNNRECDPT
LCKNCGGNQLLICKNDFMQNGIRRRLYVCESNVHGLGLFTTEDIAAGDFICEYRGEILTK
AEAQRRGKIYDSRGMSFLFMLNTDFDLDATRFGSVARFINHSKIPNCVPQVKMVLGSHRI
AFYATRNIEANEELFFNYGVLPECVKLLLERLS

BLAST