GenomeNet

>tsp:Tsp_01566 putative SET domain protein; K11430 histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43] (A)
MDILYSRKRLVGRTRVEKSAEGTPTLEETKMMMDIYDEIMKDYKQPVSKVKVNDSYLSNY
EALVQDLWRDSQRMPYPNEDRVSVVDVDTVSCFNEKSENPSNSYNLFVMKIDEKTNSHTK
NWMMIPKNFLGRPCYDLRTLRDDQQENNDHRFLPDFAFYKLVLKASEVFYNQNITDQWSG
ELILPNDRLFTIIHHLFPHKLSANNLKELFIHIFCMLNEKKGNNKLQHLNDRESIFVKAF
CPICFQFCCTTHGESLVDPMYVHNYNPKLNKKSKVKDPCGKFCYLKSLDKNTVRVLRHNS
SKSKASKVKLEWTAEKEEMLRALESLFGSNSCIIAECLNTPYCSEVYARIVKSESVASTS
WKIEEEKWKMPEIPQKMVKSEAYSTRSCVNNKVLLYSSGSSDTDSDWDSDGEGMEAYKPC
YCRGRCRDNANCSCNEREYCEKYCRCSDNCSKKYLGCNCKGVCHRKVCLCMKNNRECDPT
LCKNCGGNQLLICKNDFMQNGIRRRLYVCESNVHGLGLFTTEDIAAGDFICEYRGEILTK
AEAQRRGKIYDSRGMSFLFMLNTDFDLDATRFGSVARFINHSKIPNCVPQVKMVLGSHRI
AFYATRNIEANEELFFNYGVLPECVKLLLERLS

BLAST