GenomeNet

>tsp:Tsp_06974 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase, flavoprotein subunit (A)
MMSKLSSVNVNLLKRCLFFNPQAYSSYESRRFVSGYEIVDHTYDAVIVGAGGAGLRAAMG
LVEAGFKTAVVTKLFPTRSHTVAAQGGVNAALGNMEPDDWRWHFYDTVKGSDWLGDQDAI
HYMCREAPRAVLELENYGMPFSRTKEGKIYQRAFGGQSLDYGRGGQAHRTCCVADRTGHS
MLHTLYGRTLAYDCKYFIEYLALDLLMNKNRCVGVIAWNLEDGKLHRFHSNNTILATGGY
GRAYFSCTSAHTCTGDGTAMVSRAGLPNADMEFVQFHPTGIYGAGCLITEGVRGEGGYLI
NSKGERFMERYAPNAKDLASRDVVSRAMAIEIREGRGVGAQKDHIYLQLHHLPANLIHDR
LPGIAETAHIFAGVDCTKEPIPVLPTVHYNMGGIPTNHTAQVLTFKPGSGDQIIQGLYAA
GETAAHSVHGANRLGANSLLDLVIFGRACALTIAKTCKPGEKFPDLPANAGERSVANLDK
LRQANGTITVADLRLKMQKTMQEHASVFRTGEVLQEGCKKMEGIYKQLENVKLSDRGLIW
NTDLVEAIELQNLMLNAVQTINCAEARKESRGAHAREDFKQRIDEFDYSKPLDGQTKLPF
EKHWRKHSMVWMDEVTGRTRIEYRPVIDKTLDKAEVDWVQPKVSPADGVVQWCGKISDGV
LSQIKGITYHINDFFGQVEIPGIDFEDLKTNKKGMRHGSLSDLSYSPGYDTEKGRKMGDF
RLGSSVVLIFEAPADFHFSVSSGQRIKYGEMLGDINSQAYNLESS

BLAST