GenomeNet

>tsp:Tsp_06974 succinate dehydrogenase, flavoprotein subunit; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MMSKLSSVNVNLLKRCLFFNPQAYSSYESRRFVSGYEIVDHTYDAVIVGAGGAGLRAAMG
LVEAGFKTAVVTKLFPTRSHTVAAQGGVNAALGNMEPDDWRWHFYDTVKGSDWLGDQDAI
HYMCREAPRAVLELENYGMPFSRTKEGKIYQRAFGGQSLDYGRGGQAHRTCCVADRTGHS
MLHTLYGRTLAYDCKYFIEYLALDLLMNKNRCVGVIAWNLEDGKLHRFHSNNTILATGGY
GRAYFSCTSAHTCTGDGTAMVSRAGLPNADMEFVQFHPTGIYGAGCLITEGVRGEGGYLI
NSKGERFMERYAPNAKDLASRDVVSRAMAIEIREGRGVGAQKDHIYLQLHHLPANLIHDR
LPGIAETAHIFAGVDCTKEPIPVLPTVHYNMGGIPTNHTAQVLTFKPGSGDQIIQGLYAA
GETAAHSVHGANRLGANSLLDLVIFGRACALTIAKTCKPGEKFPDLPANAGERSVANLDK
LRQANGTITVADLRLKMQKTMQEHASVFRTGEVLQEGCKKMEGIYKQLENVKLSDRGLIW
NTDLVEAIELQNLMLNAVQTINCAEARKESRGAHAREDFKQRIDEFDYSKPLDGQTKLPF
EKHWRKHSMVWMDEVTGRTRIEYRPVIDKTLDKAEVDWVQPKVSPADGVVQWCGKISDGV
LSQIKGITYHINDFFGQVEIPGIDFEDLKTNKKGMRHGSLSDLSYSPGYDTEKGRKMGDF
RLGSSVVLIFEAPADFHFSVSSGQRIKYGEMLGDINSQAYNLESS

BLAST