GenomeNet

>tsp:Tsp_07198 anaerobic ribonucleoside-triphosphate reductase, beta subunit; K02358 elongation factor Tu (A)
MYYLSQMSLKQVVKRSFSPFVTKLFAADYFRIEYELSNTLIYRKFCTQAMKENFNIGTIG
HIDHGKTTLTAALTKVLSKTTNTKFVPFDEIDKAPEEQQRGITISIAHVGYETKKRKYSH
TDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMPQTREHVMLAKQVGVQRIVVFINKAE
MVDADLLELVKLEVCELLDEFGFDSSKAPVVVGSALMALDQVDGDFGQRSVERLLEELDK
LEAPKRDTNASLILPVSSSFVVTGRGTVVVGTIEKGILRKGDKVQLVGAGKCLDTIVSDI
QIFKRPVKEVRAGDHVGVLCRHVHHSDVERGMWMTTPNSVPICNHFEAQAYFLKPEESGI
TSCPIRTGFTQKIMCTTWDQTGRLVLTNTDMVMPGDNFIMQCILQRPMPLQVGLHFTLMH
GCSTIVRGVVTSLFNNLPVYSLKDTKTLTKKVQ

BLAST