GenomeNet

>tsp:Tsp_07198 K02358 elongation factor Tu | (RefSeq) anaerobic ribonucleoside-triphosphate reductase, beta subunit (A)
MYYLSQMSLKQVVKRSFSPFVTKLFAADYFRIEYELSNTLIYRKFCTQAMKENFNIGTIG
HIDHGKTTLTAALTKVLSKTTNTKFVPFDEIDKAPEEQQRGITISIAHVGYETKKRKYSH
TDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMPQTREHVMLAKQVGVQRIVVFINKAE
MVDADLLELVKLEVCELLDEFGFDSSKAPVVVGSALMALDQVDGDFGQRSVERLLEELDK
LEAPKRDTNASLILPVSSSFVVTGRGTVVVGTIEKGILRKGDKVQLVGAGKCLDTIVSDI
QIFKRPVKEVRAGDHVGVLCRHVHHSDVERGMWMTTPNSVPICNHFEAQAYFLKPEESGI
TSCPIRTGFTQKIMCTTWDQTGRLVLTNTDMVMPGDNFIMQCILQRPMPLQVGLHFTLMH
GCSTIVRGVVTSLFNNLPVYSLKDTKTLTKKVQ

BLAST