GenomeNet

>tte:TTE0011 K02469 DNA gyrase subunit A [EC:5.99.1.3] | (GenBank) GyrA; DNA gyrase (topoisomerase II) A subunit (A)
MNEEMDKVIPVDIEDEMRNSYIDYAMSVIVGRALPDVRDGLKPVHRRILYAMNEMGLTPD
KPYKKSVAVVGEVLGKYHPHGDAAVYDTLVRLAQDFSMREVLIDGHGNFGSIDGDPPAAM
RYTEARLSRIALEMLTDINKETVDFVPNFDETLKEPVVLPSRFPNLLVNGSQGIAVGMAT
NIPPHNLAEVIDGIVAYIDNPYITVDELMKYIKGPDFPTGGIILGRDGIKETYETGRGKI
IVRAKAEIEEHKGKTRIVITEIPYMVLKAKLIEKIAELVHNKQIEGIADLRDESDRNGMK
IVIELKRDVNPKVILNKLYMHTQMQQTFGAIMLALVDGEPKILNLKQIIEKYVDHQADVV
TRRTKFDLKKAEERAHILEGLKIALDYIDEVINIIRSSKTEAIAKENLMKRFGLSDKQAQ
AIVDMRLGRLTGLERQKVEDELKELIEKIKELKEILADERKVLEIIKKELLEIKNKYASP
RKTVIVAKEEELDFEDLVQLEDVVVTMTHYGYIKRMPLDTYKSQKRGGKGILGISTREDD
FVEDIFITTTHDRLLFFTNKGKVYSLRTIDIPESGRQAKGTAIVNLIQISQGEKVTAVIP
LKKSDDIKYVLMCTKKGIIKKTSIEEFKSIKRNGIIAITLDENDELINVKLTNGEREVII
GTAKGYAIRFNEKDVRPMGRVARGVMAISLREDDEVVEMDLVHPDGEVLTVTEKGFGKRT
DLEEYRIQGRAGKGIIAMKLSKKTGKLVSIRCVQPEDEFMIISANGILIRMKVKDISKMH
RDTQGVTLMKLEDGDRVVSTARIESEE

BLAST