GenomeNet

>tte:TTE0140 Tdk; Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MIYGSLDHGFIEVIVGPMFSGKSEELIRRIRRAQIAKQKVQVFKPAIDDRYSIDKVVSHN
GSSINAISVTKASEILDLLEEDTQVVAIDEIQFFDHSLVDVVREIADMGKRVICAGLDMD
FRGEPFGVTPDIMAIAESVDKLTAICVKCGNPATRTQRLINGKPAKYDDPIILVGAHETY
EARCRKCHEVPRT

BLAST