GenomeNet

>tte:TTE0140 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Tdk; Thymidine kinase (A)
MIYGSLDHGFIEVIVGPMFSGKSEELIRRIRRAQIAKQKVQVFKPAIDDRYSIDKVVSHN
GSSINAISVTKASEILDLLEEDTQVVAIDEIQFFDHSLVDVVREIADMGKRVICAGLDMD
FRGEPFGVTPDIMAIAESVDKLTAICVKCGNPATRTQRLINGKPAKYDDPIILVGAHETY
EARCRKCHEVPRT

BLAST