GenomeNet

>ttm:Tthe_2537 thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MIYGPKDHGYIEVITGPMFSGKSEELIRRIKRAKIAKQKVQVFKPAIDDRYSIDKVVSHN
GDNMHAIAIVKASEILTYAEEDTDVFAIDEVQFLDYEIVDIVKEIADSGKRVICAGLDMD
FRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKPANYDDPIIMVGAKESY
EARCRKCHEVPRT

BLAST