GenomeNet

>ttn:TTX_0210 oorB; 2-oxoacid ferredoxin oxidoreductase subunit beta (EC:1.2.7.-); K00170 pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1] (A)
MSFKINVRGLQLPGAGRGGALEALYEFESFDLPEQELFMPGHGLCGGCTIPVITRHMLKV
LGPDTIVVNPTGCLEVSTVTYPRTNWAVPWIHVAFGNGGSVASGIEAAIKVLKRRGVIDP
NRKINVVVVAGDGATADIGFQALSGMLERGHRVIYVMYDNEGYMNTGIQRSGTTPLFASA
TTSPAGKKIPGNLTHKKPMAFIAAAHGIPYSATANPAYLADMIQKFKKAAEVDGPSFLHI
IQSCTPGWRFEPKYGIRVMELATETGFWVNYEIENGVFRITTPVPKRKPIECFLKLQGRF
RHLTKEHIAILQKVIDEDVKRLNEMAGGEFIGPVDPEAKC

BLAST