GenomeNet

>ttn:TTX_0210 K00170 pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1] | (GenBank) oorB; 2-oxoacid ferredoxin oxidoreductase, beta subunit (A)
MSFKINVRGLQLPGAGRGGALEALYEFESFDLPEQELFMPGHGLCGGCTIPVITRHMLKV
LGPDTIVVNPTGCLEVSTVTYPRTNWAVPWIHVAFGNGGSVASGIEAAIKVLKRRGVIDP
NRKINVVVVAGDGATADIGFQALSGMLERGHRVIYVMYDNEGYMNTGIQRSGTTPLFASA
TTSPAGKKIPGNLTHKKPMAFIAAAHGIPYSATANPAYLADMIQKFKKAAEVDGPSFLHI
IQSCTPGWRFEPKYGIRVMELATETGFWVNYEIENGVFRITTPVPKRKPIECFLKLQGRF
RHLTKEHIAILQKVIDEDVKRLNEMAGGEFIGPVDPEAKC

BLAST