GenomeNet

>tto:Thethe_00683 ATP dependent DNA ligase-like protein,ATP dependent DNA ligase family protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MSMMDEKIPPMLAVSGQVFDDPDWLYEIKWDGSRTLAFLSSTTRLQDRRLVDVSHQFPEL
MKLNKFIRANEAILDGELIVLKDNKPSYRSIMMRKHQQNKLKIDFMSKSYPAIFITWDIL
YVDGKELLNRPLIERKQMLNKFVNECSIMRISDFIFEHGKTLFEETDKKRLEGVMAKKAD
SKYYKGKRSSLWQKFKHYITLNAVIIGYRTDKTALVLGLYNEENKIVHIGNVESGISQKE
LTAFMKVAKDIKVKSNFYGIKESNVQWIMPVLVSKVKFMEWSENFKMRAPSFLEFVYDAR
PYECKFM

BLAST