GenomeNet

>ttt:THITE_2111453 K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MATLEAAPTMAELDTLLLDASSFSSSTPSDRSSANSASLSSTPPTTISPDSMSLASEPDA
AKPLSAAASSIEAVIASPKAPETAQQNEPRQQTPVGHDAIVVAEQPLPAEPPSNSRPRRA
RSSLPVYNLARLAGTDVHGRRRSKGDAGLEKRRRTVSEATLAAPHDGATSDSTDAPAGTA
QSPARIAPGALPASPTTTRTATRLSTPRSARISKKSRSIRASPHLTRRSTRLSGAPVEDL
ATKLSALNKRGKKAAQKALGGLSRELKRLQDTNEFLHIDTRPVRYTVWSNGKYVDTDPSQ
PTAPEPPRKKVKVDKNAAGEQETSETGKPEAGVPATNKPRVKKWLEKGLYAGQEAPVDIF
QGLTAQEKKKLASIPELLRSSKPNRTFPLPMYNGLRILIHGRDFKLPFDICNPLPPGQPK
PAAYRTMTKNRFVGNAAAYWKKTPHFGDFASKCVCKPEDGCGEDCQNRIMLYECDETNCN
IGREYCTNRAFQDLQERTKKGGRYRVGVEVFKTPDRGYGVRSNRCFEPNQIIMEYTGEII
TEEECERRMNEEYKDNECYYLMSFDQNMIIDATTGSIARFVNHSCSPNCRMIKWIVSGQP
RMALFAGDRPIMTGEELTYDYNFDPFSAKNVQKCLCGSANCRGVLGPKPKEVKPPKQPPK
QPSEQEKKLGKGSSKVSAKGTGKGSAKAPGQSSAKPSAKRKLKDAFEFDGDDEVAAGTAK
KRKLAATVGPKRTLSSASLKGVKGAAKGAAKKATKGATKGAVTAIKRGGLSISVAAKKRG
LSSKSAKTKTVKKGATTTALGRISKKTTYGKKSQTVATATTTKAPKPKAAAPSRSPSLTI
VAAGVESAASASATATPVPQTTPRKAAAAIPASSSSRKQLPKLTISGGKTSARKWTPSRK
AIEAGLADKSPAAAASAKSSGASDGAQKTGKGLDLSRTPKIKLVNATKSN

BLAST