GenomeNet

>ttt:THITE_2117395 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MNGVHDGQPLNRADEVEHLIDAVKALILPFIRAADEAVPSRAAGELLPNKEGVVQNALVN
ARKPEDLVRELSLCLPEGPGLGEDGLLRAIGDILKYSVNTWDQGFMDKLYASTNPVGVVS
ELLLGVLNTNVHVYQVSPALTVIEKHTAQKLARLFGFTGPRAGGITCQGGSSSNLTSIVI
ARNTLYPESKTRGNQCATGSFILFTSEHGHYSVEKAAVTCGLGSSSVWTVPVDDAGRMDP
SALRRLVQRARAEGNTPLYVNATAGTTVLGSYDPIEAVAAVCREFGLWLHVDASWGGPAI
FSPRHRHKLAGAHLANSLTVNPHKMLNVPVTCSFLLGPDTAVFHRANTLPAGYLFHSTAS
SAPNPPQPATTITTTTTPTTATPPTPAENGEEDGPPEEEVWDLADLTLQCGRRADSLKLF
LAWTYHGAGGFAAQVDRGFAAAARLAELVAAHPDLAPVSPSPPPCLQVCFYYAPRGELAA
DPAENTRRTRAVVHALVGRGFMVDYAPGKRGAFLRVVVNSLTLRGTVEGLVKAVAAVGRE
VVGGFLN

BLAST