GenomeNet

>ttt:THITE_2119121 K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] | (RefSeq) histone H3-K79 methyltransferase-like protein (A)
MSIFSKRSKFRVPTEVRRIKQVVEPVAQPKTARAAILGSTAAPAAASHSVSRSSHGTPRA
SPKPASSSRTQALQSAMSSPELRRSSTTTSRKRRAAYTNSPLNDSDPESDDEDWRETLDP
SKRRKRAHTEDPARQLRHPRLWAGQNEEEDELGIVHAVEVASLADKCRPVMGLEEDEVGV
RLRYPGANYLERYELVWGRDKIDGARDIMEVVNLVGSIYLTDAQAKPFLDQDHGIYRRLE
KSKNTKDGKGFKAALQEYNEQLLALQKKGAIAQNIDAMRGVPRELVETILRQVYDRTVAP
KVELLAKYQNGTDNVYGELLHPFVSDIFDRTKLTSEMVFVDLGSGVGNVTLQAALERGCE
SWGCEMMENACNLAEAQQKEFAARCQLWGIAPGKVHLERGDFCKNERTLAALKRADVVLV
NNQAFTSELNGTLVNMFLDLKVGCKIVSLKTFVHDNKTAANDVAASILDVEHFSYPGGYV
SWTAAPGTFCISTRK

BLAST