GenomeNet

>ttt:THITE_2122377 hypothetical protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MAGPSDSPRRKHKVTVVGSGNWGTTVAKLVAENTREHPDVFEEEVQMWVYEENVVVPSDS
PHYDPAVGDAPQKLTSVINKYHENVKYLPKIKLPSNVIANPSLVDAVKDSSILIFNLPHE
FIGNVCKQIKGHILPFARGISCIKGVTVTDDKVELICDYIGEILGIYCGALSGANIANEI
ANELWCETTIAYNTPPCDQRLTNGVNGAHGAGVPVRFPKTKLTPLPEDYPPLDHGEIHKL
FDRPYFTVSMVSDVVGVSLAGALKNIVALACGFIEGHGWNATAKTAVMRRGMLETIRFAQ
EFFPESIQEMTFWESAGWSDMIVSCTSARNWRYSKMAVERGVSLQEIERTELNGQKLQGI
STTKEVMSFLRARGREDHYPLFKAVEGIVDGTFEVKDIPMLFRK

BLAST