GenomeNet

>ttt:THITE_46814 histone deacetylase-like protein; K11483 histone deacetylase HOS2 [EC:3.5.1.98] (A)
MDVSAYRYRPPKPNYLPHDIEVDDPIVEEYTIPLGKADDRENAIFFNKMKLAAQEYGIVR
PKGYTVSYHATPEMEKHHFGQTHPMKPWRLTLTKSLVTAYGMPFAMDNYLTREATYEELN
SFHSNDYLDYLITAAPEDQPRDIDNPDKEVKFNLGGSDCPLFHGLYNYCSMSAGSSLDAA
RKICSNQSDIAIAWGGGLHHAKRSEASGFCYINDIVLAILQLLRIYPRVLYIDIDVHHGD
GVEEAFFSTDRVMTVSFHKYQPDQFFPGTGALEDNGPKNEHNPGAHHAINVPLNDGITDE
QYEALFKNIIGPINERYRPSAIALQCGADSLAGDRLGRFNLRVQGHGACVRYCKSLGLPM
ILFGGGGYTPRNVARAWAYETSIAIGADTRIPETIPEHTPWRAHFIHDTLFPSLEQSMHE
PRHNRNSEKRLREIVAHVHEQLRFVEHAPSVQSQIIPPDLEGIRDEVEARLKEESEEKDD
GLRKIREEGVGQAMEF

BLAST