GenomeNet

>ttt:THITE_61645 hypothetical protein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MASSMAWRRLAAAPALSRAFRNPTRAFSTTRPVARVIANGPLRAKEASPFVSNKYPVIDH
EYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEDGKIYQRAFGGQSQKY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQE
DGTLHRFFANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPE
KDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDEQGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPGA
PLKPVEADAGAQSIETLDKIRTSNGPKSTAEIRLAMQKTMQREVSVFRTQESLDEGVRQI
TEVDKMFSQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAANRKESRGAHAREDYPE
RDDENWMKHTLSWQKTPHGPVELKYRRVISTTLDENECKPVPPFKRVY

BLAST