GenomeNet

>ttu:TERTU_0071 glutathione S-transferase family protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MKLVIGNKNYSSWSLRPWLLLRHFSLPFDELPISLGETQLSEHLRQFSPSARVPVLVDGH
TTVWDSLAICEYINEQYLEGRGWPRPAAARAKARAVVAEMHAGFAALRSEMPMNCRALRR
VELSDAAKRDIARIDEIWSQTQHQELGSWLFGSFSIADCFFAPVAFRIQTYGVHLSQPAS
EYCEHLLNHNGMRAWKAAALEEKEIVLDDEVGEDILPSIKACS

BLAST