GenomeNet

>ttu:TERTU_0676 glycoside hydrolase family 2 domain-containing protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MRTKAAVVGLALAISAGMLSACIWTKPSNESASSPRERILLDDGWRFMKYEDAADADGLV
YDIRPDHSEHQDDKAADAKPTEAVTVHGGSNVLRPWILPMANPFIADPAQHYAAPASMPP
HGDFPFIQAEFDDRNWQTVSVPHDWAIQGPFYEGDKAPVGGGMGRLPSPGVGWYRKQIML
TEADAGKSLFLDIDGAMSYAMVWFNGHLVGGWPYGYASWRVDLTPYAEIGKPNQIAIRVD
NPPASSRWYPGGGLYRNVWLEKTQPVHVAQWGTNIVVSAADEQEATVRLSVALNNQSPAA
ASVQVETDVFELNEQDEPVGAAVAKVGPISTDVEGKGAATVDSRFRVINPKLWGPRPTQT
PNRYVAITKVVAQGKVVDEYRTPFGIRTIEIDPNLGVLVNGEPIYLQGVNQHHDLGALGA
AFNVRAAQRQLELLQEMGTNAIRLAHNPPARELLTLTDKMGFLVIDEVFDSWQRKKTPLD
FHLIFDDWSEADLRSMIRRDRNHPSVFMWSVGNEVGEQYTDTDGAKVGQRLHDIAHSEDP
TRPTAASMNYAKAHMPFPETMDTISLNYQGEGIRDAEAYAHLNGIRTPPSYPQFHKAFPG
KAIFSSENAAAVSSRGEYLFPVARGISAPVADGKGGDPTSAQVSAYELYTAPFGSSADKV
FRSLAQHPYVAGGFVWSGWDYLGEPTPYYSARSSYFGVIDLAGFKKDRFYLYQAHWRPDY
PMAHILPHWNWPDRVGKVTPVHVFTSGDEAELFVNGKSQGRKQKGDLEYRLRWDDVVYQP
GEVSVVAYKNGEEWATDSVVTTGEPAGLTLTVDRAGIQADGKDLAFVTATVVDANGRMVP
TAKPALTFTVSGAGELVATDNGDATDLVAFPSAKRSAFNGLALAIVRAKPGSTGTINVTV
AGENLSSAMIDLNSKK

BLAST