GenomeNet

>ttu:TERTU_2099 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) dipeptidyl carboxydipeptidase family protein (EC:3.4.15.-) (A)
MACNQPEKGSDAAKANAEQYNEESAKAFLKEAEAELGDASLFLNHASWLAATYINFDSQE
VEARAGKEFTLKTVQFAKQVKKWDGADLTPDTRRQLDGLRLALSFPAPDDEKLASELAQI
GSKMQGMYGAGQYCMADGNCMSLGDMSKILAESDDPELMKSVWAGWRDVSPPMRGLYERQ
VEIANQGAQDLGYANLADLWRSNYDMQPEAFAADVDAQWDKVKPFYEALHCHVRAKLNEF
YGDDVVPSQGKIPAHLLGNMWAQTWSNVYDKVKPEVSSSYNLTSLIEKKGMTELDMVKTG
EAFFSSIGFEPLPETFWERSMFTKPRDRDVVCHASAWDLDDKDDLRIKMCIQKNAEDFQT
IHHELGHNYYQRAYKEQPFIYRGSANDGFHEALGDTVALSITPSYLVQIGLLDKEPPVDE
DLGQLLELALDKIAFLPFGLLVDKWRWQVFSGELAPADYNKGWWELREKYQGIAAPVARS
EEDFDPGAKYHIPGNTPYTRYFLAFIQQFQFHKALCETAGYEGPLHRCSIYGNEAAGAKL
KAMMEMGSSKPWQEAMAAVTGQETLDASAIIDYFAPVKAWLDEQNKGRSCGW

BLAST