GenomeNet

>ttu:TERTU_2099 dipeptidyl carboxydipeptidase family protein (EC:3.4.15.-); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MACNQPEKGSDAAKANAEQYNEESAKAFLKEAEAELGDASLFLNHASWLAATYINFDSQE
VEARAGKEFTLKTVQFAKQVKKWDGADLTPDTRRQLDGLRLALSFPAPDDEKLASELAQI
GSKMQGMYGAGQYCMADGNCMSLGDMSKILAESDDPELMKSVWAGWRDVSPPMRGLYERQ
VEIANQGAQDLGYANLADLWRSNYDMQPEAFAADVDAQWDKVKPFYEALHCHVRAKLNEF
YGDDVVPSQGKIPAHLLGNMWAQTWSNVYDKVKPEVSSSYNLTSLIEKKGMTELDMVKTG
EAFFSSIGFEPLPETFWERSMFTKPRDRDVVCHASAWDLDDKDDLRIKMCIQKNAEDFQT
IHHELGHNYYQRAYKEQPFIYRGSANDGFHEALGDTVALSITPSYLVQIGLLDKEPPVDE
DLGQLLELALDKIAFLPFGLLVDKWRWQVFSGELAPADYNKGWWELREKYQGIAAPVARS
EEDFDPGAKYHIPGNTPYTRYFLAFIQQFQFHKALCETAGYEGPLHRCSIYGNEAAGAKL
KAMMEMGSSKPWQEAMAAVTGQETLDASAIIDYFAPVKAWLDEQNKGRSCGW

BLAST