GenomeNet

>tva:TVAG_120120 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) Pre-SET motif family protein (A)
MIPDFPLVFPSVPECFEKCKTLTAFTKCIKPLPPEIQSFLQLKLCSPYFTRLRIKAGESQ
EIPITAPLQEVFSCFEICHPEYHANLAAGIAIMTGIPIDFIIDEMGLEIDQKKLIIMRAL
CKSTLGKTIAAVFTDDDRIEPIDSREYIPATYNWTLEGNPFQDIPEESRDFIKECTKKQM
PPDFNLSFKFTQDLSNGFNKQHGIVSVPCINEDDDNWPRKMKWIANLEFPDMISSHYVGC
DCHQHDCLTCHAIFNGQPIMKYTEAGRLDLESFRSNYKPIIIECNSSCSCDSETCKNRVV
DRKAKIHLLVCRCISKGGWGVRALEFIPKGTFICEYLGDLITDPDKAESQGKIYDKSGES
YLFDLDGYGINDKEMLTVDPKVTGNVSKFINHNCDPNIITIIIGTVNSEQYHRIGFFALR
DIYPFEDLGFHYGYKMHKIDQKACNCGSLTCGGRLT

BLAST