GenomeNet

>tva:TVAG_230610 NAD-dependent glycerol-3-phosphate dehydrogenase family protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MPYKLSIIGSGNFGSCIARHCATNIKNVPEMDPHIKMWVLEEIVNGESLIHTINTTHENV
KYLPGYNLGENVEASGDVVECCDADFFIFVVPHQFLPATLEKMKGHVKNTATGCLLTKGI
NFKDGKIQLLTDTVEEIIGIKCGSLMGANIANEIARGDFCESTLAFPDIPERETWKQLFE
SPKFKISCTNDIVTQQLSGTMKNIVALGGGIVDGLNMGQSTKAAILREGFVEIFDFAKMM
FPERGVDILTMIESCGFGDIVASSYGGRNRKCAEYFVKSGKSFKECEAELLNGQKLQGTL
AAAEVYKILVERKATEKFPLLTTIQLISERKVEPAEIINYRNHAAVTA

BLAST