GenomeNet

>tva:TVAG_344830 thymidine kinase family protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFAVGRIELIFGPMFAGKTTEMLRRISRCEMAHKRCRVYKYSFDQRYSADKVSTHDYFMH
DAISCTTLMPHFMEAMSYDVIGIDEGQFFPDIVVFADQLANAGKIVFISALDGDYLRKPF
GKVGELISKCESVIKLTAICRVTGEEAAFTERTVKSDQLELIGGAESYTSSSRTAWKKFN
TSGCINLTIGPVKSGKTTELTRLLVRHKIAGKKVIMLVNHEVDTTKVPVEVRVINALPDL
ASMQEYDVIGVDDGHLYEGIAEWADDFADHNKKVMVAAADGDEFRNPYSHILKLFSFAES
VRKIDSICMVTGNPAPFTARIDGKLVPISRLGIMSQNSINSYTRQQ

BLAST