GenomeNet

>tva:TVAG_344830 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase family protein (A)
MFAVGRIELIFGPMFAGKTTEMLRRISRCEMAHKRCRVYKYSFDQRYSADKVSTHDYFMH
DAISCTTLMPHFMEAMSYDVIGIDEGQFFPDIVVFADQLANAGKIVFISALDGDYLRKPF
GKVGELISKCESVIKLTAICRVTGEEAAFTERTVKSDQLELIGGAESYTSSSRTAWKKFN
TSGCINLTIGPVKSGKTTELTRLLVRHKIAGKKVIMLVNHEVDTTKVPVEVRVINALPDL
ASMQEYDVIGVDDGHLYEGIAEWADDFADHNKKVMVAAADGDEFRNPYSHILKLFSFAES
VRKIDSICMVTGNPAPFTARIDGKLVPISRLGIMSQNSINSYTRQQ

BLAST