GenomeNet

>tva:TVAG_347480 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) Alpha amylase, catalytic domain containing protein (A)
MKELADNPLLDSQDELESVERESEVPFYKKNYFIYGTMICNSILIGAIISMIITFSVNSK
VSSISNQYDTLPNCESYSSFTCNGSSSSMDYKYYNNTWNTPKRGQDLWKPGFQDMSTLVG
YAQLKYASGMKSCTVNILTKTSTSLNLTYYFDDVAQTSNSKTFDSSYTKTLSVKVVAESG
ETLILDGVDFIWNVASIKSRDYDYRKGQKGAIVELFGWPDDDVAQECKFIADAGYMGVKI
FPHQEQIMSYQPMENMMNPWYFMYQPVSYRLQGRMGTRDQLRTMINTCRALGVRVYADAV
VNHMSGNGNDLSNHRNSGSGCTTWGNKTSSAYENGSPYYTPAYTYETNPNTGRGTNVLEY
PGVPYGPEDFHCDKALNSWNDANILDSGWLSGLADLDTSKEYVRQRIADFMIDLISIGFS
GYRVDAAKHIRPTDLAAIFGKVKEGLGGSLPDDFISWLEVLTGGESQLLVQGDGDYSFTG
GLTKYLKANNFTDDDVLKIKIWWSGYPSEPNNDNGSLDIRRKAIQNDDHDQQSDGSSSRD
MHDQGCVLIKGCDASTHRSFEVKLFESPNGLSNQNGPFIIL

BLAST