GenomeNet

>tva:TVAG_379550 aminotransferase, classes I and II family protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MSLKTISRLFAYSPRYLQNARALNINTVNKEVVKSSYSIRGHLNTVSDQLRKRMAAGEKL
PFDSIIPCNIGNPLAVGKDPLTFPRDVVSCIENTKLLNSADISEEAKDRAKQIIASTGGR
FGGYTKSQGIEIVRQHIAEFMYKRDGYPCKPDDIYLSDGASSAISFLMTLLIQHNNVGIM
TPFPTYPVYTSEAAVHGGKIVPFYLRESNNWSLDIEELVRAYNLAIKEGIDVRCMVIINP
CNPTGHVLRPETMRTIVDFCEQNNILLIADEVYQDVVYNKERPFYSFKKIASQMKSNIQL
VSLHSISKGFMGECGHRGGYFELYHFPEDVKAQIFKMATFGLCPNAVGQVIVDCMVHPPE
APENKAIWESERNSYITKLQQKSVKLAECFNSLPGIKCKPADGGWYLFPALSLPLKALEA
AKSCRWQREVMPPDFFWCLKLLEETGVIVVPGSGFGQVPGTFHFRSTFLPEDEKFDQVIE
RITKFQNEFMTKYD

BLAST