GenomeNet

>tva:TVAG_440830 SET domain containing protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MMMNKRIRPQRRHSSSDSLDNPSSYDEDERKKSFSNRMTNREDKSEIKTPTRSDSPKVMN
HNNKEDKKEVIRSRSKNIQQNSEMRVTREHIRHENADHPSQIEKRERFENHRRPNRENKD
LRVKIDIGDRKTTSHDHQREKKEKSSKIIPQNEKPKEPKIKFEKPSIPVPQITKKVKKET
DNINLPLPPPQIPPETEDIKPAVISRPKAQLVTGKIPKCSRIVPIKCLSFKKRDKYYRAA
NANRKQLDIIEETLKDEERQNQKFYQLLSSFKGANSDLISVELDTKDMKLNYIRFEKSKI
EGFGVKTTIPIRKGEKVIEYIGEVIRPIIADKRQINYEKMGNHGTYVFKADSDHYLDATF
RGGIARWINHSCDPNCESRIIKLNGRFAVVLVAIKDINPCEELTYDYKLPYEPEDKAIKC
LCGSPNCRGWLNRDKNTLDDKTFSEVKFKNISEDVLLRLVENNILPIDLFKADGEFYVSH
IDKDGN

BLAST